'VT4GU-Boot 2014.10 for am335x board` @ﾭ (OР iHMP  H4P  OР iHM  H4P  OР iHM! H4P  HOР iHMp! H4P  OР iHM! H4P  OР iHM0" H4P  hOР iHM" H4P q }1) X @ //   /@-PPdyP @vYP` `0cy@P `@jYTp0S ` 0SyPQ @dY ЍABU3gB@--x 0D @-`MPP@Y @4 @UV  @MV`ЍBBBp@-PBXM0 40S0S #?00?/A-p`_0P0PSE@ @Gdd T0@e@0 D 8T0e0T*6O@0?AC7!D/@-0 //D(0@+ 8 <0 "#30/Hv;0 ,0!3<S<0`0/HMb00<0, " # b /Hv@-@d@-/F8@-0H@LP$J%ZT*%@8?00?/@- @Bc0 H 00L0/ P 67007 6/D P(67007(6/D@-@@ 0Z~P@ 0R~Ѝ@-  剧 內|@GL@G\П M Q52:*<Й帐I @,9,, P 52: ,@0@,/ pL@P D Q:4 40QR:/,/,/俅@-0 0HL  0 &Ѝ0s@-P@0L`0QP  'hSX0TTTS0S  00D T6/ЍpuD|D^DD 0 H AL0  a'/@-`LQ R ZP,aS0SADP     p R R 00_ 100 10 0H L    Q R  a 0 L<  0( 000 DDAT/ ATATBT@-PP@|` \ PYT@-D0$Q 4R(0 0,00 R(oDE0S @-@,JP P R@6+E3E0/ 8000/@//@-UE0@-M@ 300<8 0,0@P040R($ 0R0 00R0  00RUNnZ z C0c0Vv\R@0T P @0 1400yRЍ0dhEEEF1F\AF@-@ iR`F@-@ aRwF@-@ YRF@-@ QRF@-@ IRF@-@ AR}F@-@ 9RzuF/@- $RP kGM000cS00Ѝ/0/@-OJO@-OJOP/@-O@ @ T0?0?O@OO@O@-OO@OP//@-44N} ,OP  ? @o AGGE-P@.`PPhPpF'`T  PU `@V 0 0aC1%p.m۶@-@ 8Q4QP zQxQ iQGGHM-MpPZ@`G1 ` 00M0 Ss"!0EZ@%p@0 0(0 $ I(0Pp $  SW JpeQP W | 0Wp :7P0P0-SP0 =SP0 +SP0 03I 0P* 0PX  0 0P LP P 04LS PZZ P :00U 0S ppp0S@ `P00nX @o ` P`TЍsCA-@PM. 0S+ P 먀pP 0S `JxV00 0p`@K 0p0 0@Ѝ00TJM-8MP0S  B Bo/o" Q*t7 P  R RR  R0 p`0(0000$0 0 0U1 00CS LJaJP0SP00@TppW p@pWp0D( 000 00DR?o20SoTRr TppW T0S 0S`00Xj 000$0,0H 0 0P 0? 0S0 S 0Pj 0 00pH,0  0$~ 0 0  0 ,0 0 000 0 0R J 000 0 $000 00X0 J$J0 @p0 P J0 0 00 0 T T0S T0S0000000S #S P [` qP`V Wp0P {=`KP\J0`y00V OJp`p0` }P  `a00V 00C04Jp0SP l(P, 0PP00,0pF`000Z- , 004pX` 0S  40p0S 0000Z I0  "I@1` ;P 0 H 0`v 00f0,` 000 R" T # T  V  0SS @p` 0S @ @p @00SPPE(`8Ѝ3x6 JQ5JM-8M@ xP`4$`p`z(`0`,`Lf $<sF,P((6000p  0S 00 03/p % ` R [p  2/pV  FR RVxP [_ [  R V &[ [( Rp&[ "[ [00#[ $[. ;[ '[00\[ |[ 0S 0S 03/ Pp 03/# w   03/ 2/p `   00003/#p0`000_P0S5 03/?P {P. 000 03/   p mjg 03/D 03/}Pp Z}PET4 0S? K 03/'Pp/000?o20&W 03/ |W 03/0S  03/Ppqp1 p ,0S h1 ,`V' ,0S 0/H0S,G00 H000w, * 0RP!L7 {P u G l0`R`\PFu80`P8Ѝ6;5NJ5RJVJ[J`J3J00eJ@-,00$0000 000 >Ѝ078@- P@`t@P@0`t@40P@t@ P@` t@ 0eSrPp0`@0t@iP@pt@P  p@-PH`@BToP @BPp}Bp蠆@-P Ѝs@-B*4S }B0*4P`P 0PS S404S S`$4V0$4\UZBV\M 40 4HP <P 0PS0;41`C44UP 5P  0P 0(4S $4P0#S |P(4S  匸 $ 44P R 0s0 $s0RЍp@aHeIeDaJeKeE-0 R@@#00(40CD)D4*DDD D$D0D,DA4S 4n ` pPPUf Q@PQ4SI4 $0S0  Q  Q5 0Q  R  ABQ r xR0P0@AA At PR00 a0AS P0 a ARW0AS 70AS>, 0Q 0S,Ć0*40 4t PpGW(s(4SCvA404t@ Ѝ@a M-D`pP @V)  Q*$RjZ` PP: $Q.  *$Q ,$R ,$RT 00Q  a$K$ R\ QBR\ RR$R \\ B$ Br QPAu" uA$R ($RC A$ $PAU )$ ($RC@$ $U0 Pd0$)$R$V `jx$ p j$$ uЍ@a<0@-$$(0 \$$ $ 4@ Ѝ@aKKP@-@ t@40CS@@@@@@@@0)44/P@@aP0/tKM-MP)`U)p*UD @+pUp  0QP+0,P $00 D000x@0 d0@\>P`  `TU40?(> 0H00`pJMTM^MMhMMte@-0@PtT`?P0%T00S bp?PP ?P@VP:@D0? ?U @teMM/// 00a40/ //,0>0,0/) ,  a, ,0#88,0, //4,  a, ,0>0,0, < /<048<0/0.@ /<00C<0< D /H0S H003?:00P0P<  a< < PL /<00C<0<00<0< 8 <00C<0////@-]@- ,0 45@0DL @-R LHP L H @-?M@- ?]M@->^ >M㄀@-  @K=M@-@-Q< P B< < P K///0@-@L  >@-(/@-!( N(0 @(4(( , @-  墵PCl// 00b 0/xe///@->fN@-@-> N@-0VD@-@-{@-@-=@ <N@-r,@-C?@- @-000u/@-@-60/Rp@-@@P `06>E @@->pNFNE-BXMp`P@) |0:PP#PQ C E0P | \ Pd= 70(0 000 0Ѝh|e O@-@ <@LM8@-@=7DPP P (= 0RBP=vC=BP| x=p=\JP` JIPH@=PP84OUO'VlOOOOOOOO PR@-H0@p@`P PP`Us@-PX`;P@e@P404`@i= 0:Ѝp#P-P1PE-PB@M` 0@0p00^U000   xFP0  c P :0 0< 0005Ѝ|e@-M@p`00P0 00CPX 0 00@00EEPP $< Ѝ|e7R\R@-1@)M-@Mpd@`P 0$00 hV/Er;EBB HW00 W8< 8<C`(Cg|xCP P3 I< 7尰R <#AP<LB[ l<APX< L{<Q 4<d00x0 0< |0080MJP <0LTP080H0 0b<o |0|SW BP P ;000000 03/@00t003?0.L TFP ,/<nL TFP %<pQ`L TEP <qL T03?0t0FP  <rD0T%S03?0 P0S L 4 FP` X;1 5Rpx  )0S@0x0 03?|0S$0@䴟@ x0 D0ySS 0;M  ,$0A00Q0S 0SS00$ Ppw p0x`(0t0,000|080MA0S :S G V;; 8 8@ ; 80EP |v;8 @0`$ #0040y;8 00.P<  0o;`/ 0 \;0 f,0 V(0#03R V0 ``RSp`O;D0S "0S9; 6;sbXH `>\v8 000 aoBPm,Y8(V8  `Ḱ B  BPZ 00P00S1@8 > D  +0`X 9vv  $ 0/@ 0;/`P $:$p. aX v@ : 0;/`P   0;/`P X`@Ѝ|eRR'VoOOOOORRSppppg;p 0  0\- W  .RR&pW,p0  0W  S 0R XR \  :RRp\ pw0 06.0p p)X :X # 0 6p 0 @ \@R5 P@X 6 P < 0 ,p6Ѝ@]YYYYY  $ /?<@-MM0 05P@%PP 0GpP `@P d 0`i6X(ァpp08( 4\6,L6@؍ЍCѻZ:ZEZ4@-MM0 P0"0PSGpP `ÝP p 0l46@`?@(6pp0<, 8%654؍ЍCѻoZ:ZZ@-@|`4po<PP P! J L1RH:P45EW :P 0S @@1Q 0S-V' BP" ?PP5 dBP W AP|  0?P`T5P 'P ЍR'VZZZZ[[4M8[V[i[x[[R@-@0040 D0 0?P 5uЍ[0 5\0@-M@@D HL@PP  g5T  r"@}3 P U5P5p3K5H5xp,h@`8X<Ѝ0\(\4\>\G\O\b\VD\l\w\\\\\\\\\@-@HP 8P ( `]\R@- R@P@ P P  0P4@$A]E]R@- R@P@ P P  0P4@$A]]E-Dp`4@T 4 4D|PRS0.0I.O.,DL41S<4PU 4@ Ѝ^^GE-pPUUA q4p?`P pp@t4\0H03`Ppj4g4PW T4^E-Pp`U*eu\a%0#\p @! @1@;TpPP` ЍE-Pp`U*eu\a%0#\p @! @1@/TpPP` ЍRA- < @  `z puPSP pP0 x4 0XPpP0 03 0@3Ѝ9_>_rf4@-P`(p3V @@F$0 P  R 0S4G `0/@- ,0R(1S 3ELF`7`RE-p`@P R 0-S @ P@0PP@1 T 0pS@@2X R 0 S  c @@@0c3G @@Z3e``Rp@-` 2ՀM@ PV@ 7PbPq:3+3X1PB\  PO1`P BP ! 3:x 0p?1`P  1\\!0%*H@!<.1`P ( $1`P  1`P    P ! 3f P!3 P @2 t2l24/\2Ѝp```aD(a1a:aAaEa\NaTa]acalasaaa WR@-0 0c@-r Ѝ@-偌 Ѝ@- Ѝ@-u Ѝ@- Ѝ@-T Ѝ@-c Ѝ@-֌ ЍR@-Mpq2P@ @0zC`P pP  0[2ЍeeE-RM@0 0ʵP.`` 0UCP% přPP  0|62    Fp0 $22PЍf1f\fp@-P@T 2K`P#l2 v1QP 103?S 011(@1@ppjjjjTJQ 00S SSt 0S   QS //QQ/QA R/6;E-@QP`P $`1VV 1`1`PE1p@T E1`10Tp堠@DADVV`1 1l@T`}1HpHV DV@`  q1,Em1jjkkkxkkk 0.j%kRM-PM#p0aS6`R\=0S 06 3P2 8 /0  P00##P" V4   03?R*  $1%P! : 1\0@S 1`| `P.X gP  ^X003?  T  2/P0* 0 P;   PX @BP ]Pd 0sSX 0X 0o 0PH 0 <R(˟ `P0p0 # >Q_ WQp!   0 ` h0R0 ќ  Q [R)l lʟP0`p0 # ]R R  Rp!   D  0`0HW 0]QdĹ` q 0 00X`10 0` PL49` L9HP?X@ CgSX00`7X0sS `0P+PnU sUXPP9 0 0P`0& nRp0  g 0pP R R PUnR  A 0P0sS  -'0 ,`Vp ,a0vS#P V | 00V00S @ 0 @@T  , eaS   sSq  `,lPCPlS ``XĦ X PP pPU @6 0 `V@  dz/Tu/ F8 0@SYT謀x !U0 %P e0%\ J/PU?ڨE/0pEWP7!e;/WP0  p10 3P C,.U e/U e/ S/ e /Uup PlP.X *`P\`PD0hSA0,cP1.05_1 .01.0 1.01..01.U01.U 0 1.U0|$1.d.`.X 㖿`P 00 刿PP ;  5 0o} q`PL00pS!Ppg.e.Ui 0Pw`dW.\$0TP 0 000L.aS   0 `P:S dS `P+D%.* P`H`XP  t oP   $`P`PЍj%kFkhkkk#l&lYllfl6;ll m|m.m(m$ -kMmDkUmqm3mwm~m{mmm溄\lmmmmnn1nHnVnmnnnnTJnnnno   cL w@P4 f,ЍpY7oP&q2qooQq@- a 0 ЍM-8M,pPEk*P( e*P; (`(PF\*@P2  E  0PP T  pT @0S@PU00 X 0P>0P0 8 06 ((`8ЍUqVDSD^qyqsqiqA-PPM+ p@`pT 0M SR@ U@ 02A- 3? 0 >0@d4?00@0PЍ@-唅 Ѝ@-壅 Ѝ@- Ѝ RKA-R@$ppូWP< 0iS cSP 4sS tSP .PP`J@@ +UJJ@ U U@JOoBJ@ 0n+x J/΀GuPupu0 .R0@/R 0S/RA-P`@B 8p}P  0A//`@-xJ@xJ0YKA-BQ1 P pp|@P`  rX j@0aS00 0PJP * ռЍ=vRA- # @H ppC`~PP 9 4 0JP *ЍVvR@-` j`hP*V@ppT00StJP,*P@T *oovvM-R(MQ@p Y`P  p@Pp[  տPU `` 0` OJ0P W*#0_*0S0X*00V@D*0S 0 A^Rx:*pD*00 %*PfU0 0@0p0(ЍjjjVvvv„>FR@-I * {d d00b` C1P@:H*8 *I@P  *v.,/.vvvR>E-M @Q pLPPp)  @@ E` ) 0eS0 00I PP@`T ,) )Ѝ/vw*FR@-I@H) @,)I@P )w$w@wR@-@pP@gDAPU! HP0( )x) @g۾DAP`:Dr)H0 ( j)h),/..awTJvRE- PḾ `峾 p 宾@ P ЍE `dwpPQ0 @@ ,IP $!)   ЍlwR2E-MP @{ `vPp  lP1#U_  bPv@ 0HP (ѺЍ/VvRnM-p!1 M`P@  0) @3 p.PiPGT1(! T!(BP[`PV+ (@  0HP ( T  T0`3?00`S @  0HP `z([P 00P0 Ѝ/jjjwwwwww<_=v}/@-@ *R T T T 㱽A00*S 㦽$S/0{S 0 }P P/00U&/M-PCq`hV00W  @PO4XKU0  P` UBɀɀɀɀɀɀOoB9@@6O4P!P#@O- p` W"0ʀ@ʀLʀ\ʀlʀ|ʀ@`OoB@V@V@@V@@ V@@ V@@`@'Ѝ`#wR @-@ 0Rˀ,ˀ,ˀˀˀ,ˀˀ 0 u'o/x0 0 0 /4kHk@k,0 (0 $0 0 0 0 /8kXk4kP !$0/S   ,  0*Ph 0   0P < 0     Ѝ0 À&17@-P@ Dp00 -R0 8 Ѝ0s@-`@ Pz0S -Q 0S  h00S ЍpRM-P6`XM@ 0H I060B060C060D060E06040H0娱PI@͕00ӅI0ͅV BC V DE V  ڵH0iSp9V,,fB@PCP@T.G00L F0P"GLFP000 0 0 0,P t> @t@@4rSBP@3C0S-:D`E0V X0  c HP  @ B C0RD E0R    `v`BC Q D R  PuPwSBP@C0S:D`E0S: 4%P D @`v`PuPH ްPD0SE0SB@00C0 S:DPE0S 0L0  0P x  @00PuP0S D0,0,0S 0XX080`S10 $3  0 V4 (0V30064020800080 0Ro*0   2 P<00$0q 0y0<SQ=@Sd2 ` S\"004 L 00b@Q/( ,ŸR(2( 0X60S0S!00S! S!  0S0S00S! S!  0 Q)x&$0lS 00Xe0s@H  @PVK\0H I  B D0 C <0 D 40 E ,0 $$0 XЍ/kkkkk|kvUYف!TJ'TW#4 łλ]`؂diny}#Bdks RM-B`M@0P`P4 0( D$ , <$ 8 4$ < ,$ 0 $$ 4 $尠0 04`p嵯P00xSPP 40p(0,00S ( wVR $0rVS00sPPrV wV0[M  Hӳp[@ !.K 刯 0P b@ 0 )`0 @8 K< 0P  0<08004 vP[0KKS[pP 2P40p,0(0(, ZPlV~,0rV(@ 0800<00% wVZ000400 0TS0X0[0 S00( 0 PQU $⤯00SpX $0:SS  Q:S`p 0SJ $⎯$00S`BU $ ワ 00S7 $00S3U  $t R0( $ R #0 EPP K 5@P vFP\|u0StA lPU PڪP @ժP $ ;00S $00S $ . 00SP $00S$ !00S` $00S0 0SZxd垪P@KV0 0ddJ0P0 ğZ 007  ?oX20#SL 0 0hS0p1p!$dP j0 d`q( 000S 00S P$ 0+SP+$0S` 0SZ 00S C0c``0 S00 3/ 0P@0 /`pd0(Ѝw(kQ9_rfђj풄Mb /#|Lh6nE-M`R0 0FRpCB  ϭ 1:Q  í 0.S 㺭W$  㳭W 0 p 0 Q 00As0 S70As0SW0As0S0 2 00  Q,0 p0@005N`P #uN000 0OP@p @  00BT@\T@NSNЍklkkk}@Bk•vTJ//RM-R4ͨ$P`B@p0 "  V 0帨0P  VZB Q񟗀, 8 D \ t  @ x 弨幨周?o2n勨00h全?c倨PA 3 .00`?o2P %  00S0C  0S005  0S00'  0S00  0S00 0q0R R Rp' W?o2U000 USX00PPp`j AVB0oЍ`"P P :P Pd/ P : P P D/@/</8/4/0/,/(/$/ᛗ͗ėyP8@-@P P P9 T T0U *8@U #@DT ( |xtUl h5:PU` H8@Hyݗ +0BQU^(kxiw8@-P@P80S8@ T8M-@Pყ~p`d 0S0P$Q 0 S/ \!0C\\ 08@Z0  C 9(4X 000`|    H`!00CS !10 1P ` 0 &P"Pl9S` 9VP `Ѝ|`vQ/@-M?@)0`V QV`1$ & P71S|00 S0 S @S0 00h0`pd0wp0p`` ` 0P@ p㬢 p 0P P  (  PB? 1 `Q R a `p QXmvPj 0%PD0xPi R Q2 0QJ Q 0pE? 0R R%QC0 S aVڤF010 Gȡ 0 %! &!v0#&! &!R <7%0>00⨡0 $ "$ RQ00Z 0 n⋡P1U '` 1V `1dh !0000 0 PP+(p lPpPH`J F BQ  0+Q  0$Q  0 @d)@ߍ,[ߢ CSyͣ𣄀0¤椄 +s@- 0@P` @&-00&M T {b@p P` P V pfx00\fILH_0S4YЍp@l@lcDmХ奄/@-r qh0 1  #0d   YЍ@-h0q10 0 d  FЍ@-r qh0 1  #0d   3ЍE- pM?`@?`Pj9UP  P9UP P9UP  ݠЍ@-)h0r 10  0d   Ѝ/0 /HE-M?@P?@`p s㳠 P 가㦠pW 㰀Ѝ@-MGp`?pP@ bP90 0m  ?01S ) } PqH $ , R   R   R  Q ( $I iKP 40(9 9Ѝ"M-.M0`?`S ʨr @ePPxO Z # UP ⾟ 0 4 0#40坟  ◟0 p01 S00   R0p 9h0 d 1 0pp` 0!P9Wp&꒎p9W5_0?00圹` P%0尰Რ 0* 匹7P .      p  0 S0S .ލHL.0!!! R"!R 1S>0S+10S5/9 R  /@-@M h01  }/ !0 P09ch0104 JXh014 @NЍp@-(M`@ P㾞 0000h01DP  !0}/  X-h0104 h0104  (Ѝp@- h01 }/0  3ЍM-FM0WD"P`@??Pq0 RW3p$ h014 7 0  p 0}/  0PPZ0ɞ h$P0 PW000S}W  }/ xP9 W  P9 P 0p Z ,?P `0R0 0CS 0S C/o0"S00SFߍ!USBCUSBSM-00M!P!0R3 h0@104 @0h@0A4 @ G0000S0_ h01 !0 }Ϡe P II h01  0 I?`V< ሠ  V 0 0p 0,0 0}?00$$ 9S  $0 $0 9,W ,W [K , pW `V0Ѝ!s@-0% @0`$0S  ^PU 0S ԝP ` 00 R RR 100c!R RЍpOM-MMG`@?`Pp 9 0Sq  p 1#4L01M01PS_ R09,03/Y 0S 000რ20000@00 R0   00SS0S09 B0S$R#S! S X L@ Mpd F  pW L@ M(K PKnp@- \@P`埜00020000@00 00003/`pM-PRMfq@`p00P t0r# 0R L!t0p!"<1 0*@ T A00 Y0* 0  0" 00 `0 0 2/0P pW0 (,t X( X$   W tw``+ 00S00Pg000ЍPM-PRMfq@`p00<P t0r# 0R L!t0p!"<1 0*@ T A00 0( 0  0" 00 `0 0 2/0P pW0 (,t X( X$   W tw``+ 00S00Pg000SЍP00P0t 0 /ᔠP\0p@- RL`P@0T4* td <@p! p蔠PܦA-`QU Pqp'!1S"10CS@4 lP`P"1 0#1S 0 :PS X100T1P100L1,0h! 4 E+10S*10 0 0+1 0S!10 0%1%0 F? R PP 0S 0S 0S 0S 0ASx  P % R % h0104 {,0$9PIP5t3:D4CX3M-M0pB?p`Pp 0 00 00020$000 00003/P Xtt 0 R 0 0 Eޚ Z ښ0 p$0U0^0 Ḛ 儰 " 0 2/P ?p ?p   p墚t1B0Sd1L0:SK dpWF 8博%000 2000 00003/P Z --< 0 0002/ 3?0  0R   Q Q( #8R8  S {<BL M0 Pm ܍j̪|PM-MA뼡q`t P&t0 t@ 0p``VlPDk0Di0D pdApPBPC L14` 02"0PQ33 _`?`h01 00D }/ 0P` `t Rʜ" 0 000P   SP Uo8`P`ЍǧP>4=L󧄀 M-@d3 M\PX 㢝XP  㛝X`p  㒝`P@ P7 r $ 2R P0S0000X0S t 0S \ PL H W8%* 0 >[9  P0 @P U xXPI0S P  0Px  P`0000H*X,@T T  @T TP1X#a& 4`@e 0M~P ~@ dv@ p `F ЍR<'VoOORoOOO[4M8[i[x[&G_}TaVRA-@MT`\ PᆵPK 0SHDX1  $zpP+ 0S( !@DT1!  T T    @C0S 0儵 0P  0@S }P@ `@  S 0HD@0@i@Ѝ`(Щ٩/|e R9@-@` p!"PP&V ֗PY" @:~gDP P @T@PY@D@4!T '/p쫄mN7@-P@P@ 0S `PP DP ፗPϗP Ѝ0Xx@-@P@'`᜗P |pPᒗ0P}SᮗPP  @ӗ႗ @?o2@cЬRM-0MP@FPU   㬛0SP 0S  APO0P0p0 h4`$P gL0 偗<t@PPC$$P$@$R7 +P @& 0@ ;R   0$0$0PU  $ 0;S@x* `p pMPt@ 0O  @P4/Pm $QP$$$Pa$D┖  PW $;P$$ۖPO$႖  PE $) $P$$坛 00,00 0 (0$ 0,0(((0 0 P $ $P$$z 00,000!(00,0((֕(0 0Px`Uz~PPPUPcLTP0ЍrfӬ8鬄` BJ\A\sЄ@-PpU`t @000  -RPE R fRp PEU gP@R-,M0  < 0000 0(0 o,Ѝ/@-0tARA-P`@B 8p.P  0A//0@-@P,M0 0 00000@ 0(0ڐ@T X@ @0@49PP,Ѝ0yI^R@-@  -Q  aR@D0T P`pP L LP,`pWIM-@MP pPEU* 0-S(0S dS bS cS rS tS PP pP p@Q][PlI W00S @U` 㚙PUPP U#&0PfQQ S#VP Z PE` ⓕ D0P @(@@ @ `04PP0P P0L0*4000Ѝ虯ˮȯ&8H @- BR -^ ^ a^ f^ R Q <| ,R \ @'E-,MpXP`=ἔPh, 0 -RH R fRp H(!X0000S@ Ȑo6 ⠔Z@@1P}& Q0  R QS C00`0@`0(0@ pc0S(0$ U,Ѝ"X rR/E-@0MRp00 0000@ 1B 瓘00SpGa`WP@  302X@ T?0@C?@ 02D01D VVa⍿40V  ÷0S00;ߍ螰<_0/@-H000 00 Q 0S  Ѝ䲰@-@@@-M @ژЍτM-P @@M p EZ6` -R3 R& cR bR (sR tR #T TpEZ _ `T p@0 P<IG ۗX  ۓWPE` P `0ُ P0 003 m j!p[@`P 0p 0 0h @PPX0XX 0T03A[  m,e@Ѝ虯8 aV@-PP@p`W0@=S0S=PM-pᰠ`PP@P T@PPfPyP U@fT 00E00@-@,M P   P 000 0(0P ͍PX PX,Ѝ07@-P@P 0S Ѝ08@-P@P  8@8R@-M@ P  <妗8  㩻P /܍iw* 0/$ 0R 00/?<@- $0S 0/?<@-P 0TSYS001P8@-$P@  $ r$P@8@-@P 0!S|D@4@d00@0^$0 0HHhP<0<< 080{0*000ЍIw?<8H @-0^$00 0  FЍ?<Q0@-@M  ₒ 30P |@0000 0XL $@P0@00 8088 0400(Ѝ8 @-M|`0@pPp#h` @@6P H0HH 0D00 Ѝ*8 @-$0S;Ǯ @U@S꧴M-0P@ p 0l `pP 0壑 K0X R  Q0 0Pc40  {W`0 101Ѝ(XDQ% P#8@-P0@S 3/P8`0TQ T 8T ,T0(  8T  T $ T0 8/iP0,0//P0(0//P/0 4P/0 4 R/0 0 0/4 R/0 0$0/4-@-"M@T /( @"ލ@Ѝ/@-0"M @"ލH0@-@T @ 0S P P0@@脡0/အ0 /အ@-@ P 0P@- S@P @<@-`@PpᑐP  勐P  l児P  T :T zɱ Y  /p@-@P R 404BU0\PT00S@TU T U 4P@0`@ST000p\0Pp@-@P`  b┐000V:$00V`pp茡ġ zġp@-`0PP`N@N@JD T00Pdp 0bSH00a8p0Pd PP0@d@pP/0@-0@ Ÿ @PTQ 0a   010R0810@Q P0` P P PQ @PP00   Q 0 R *!B  0 00Q"8Q[ TQ"nUQwTQ"|~\ P  A Q R: 0 005M-0S50SlP `UV`~V*`1! P P06 0 00  4?0 S&380S[0 TS&6n0US7w0T%S&9|0~0 \ 0 00   ) P   f\0C0$PS  @fT 0``00  @ T 000 \ *@pL!  ,$R,#8 R[ TR,&n UR'w TR,)| ~ As^ B!@"  ^   \:  C!"RJ0 0 @ P  pfW 0``  00  pW 0   0 0 @000 N0C^ 0 RRP @  0pp0fSg1@1@ 0rJ@@N@pP  [0 [XI:tXP1@@0@40 s`01a0@c>0>0@p' 0 00R0h000 W0 0 0 pGp 0W000  t 0S0d S00000fS 0` `0Ѝġ@-P0p `uPQ$ @0pb@0oSrpW` F$RR0 R0$R00    M-@Q'TЍM= XDPUh0S     S `R h  00R P0 0 0pS pg```l S9 0\f` 0 0  E$RR00R00@ 00 0$R0 0@0000 0 @      塍0 h000 [- 0 0 0 0  E$RR0R00@ 0 0$R 0 0@0000@0000000g P'V* 0 0  E$RR0R00@ 0 0$R 0 0@0000@0000000P79h`P! 0 F00R00P(  E$RR0 0R 0000 0$R  0 0 00000  0hS    0    0 000000ЍA-pQWA W PpUPPP @HQ `G0g```F0dS0`@d00d 0    00@@X@000eS00PPIR@- R }0@-@M@@  ᩌ @ >03?co@Ѝ 8@-2/@@403?co<0 R/@-P`p@V # % %(@<A!<@2/ ^ 03?00 @- P  @'芵@-H@P  r,0P  i0L0`蔵@- P  [@ꟵPA-P`@T Tp1p!U (P`@g@-@ @ĉꭵTJ-0$,8`pP0 '$ 0 2/ 2/00S Px` U 0  Hh t0 0R0S @ PЍ„3DUdu8@-@P0S P ΊP8 @8 c) Np( 궸P* )s@-@P\`00 0P P  0 P Ѝp@- 0R ُP'V/H/E-4M@H PpPT( 00,009PU6 lP $' P0SL`2` (0P& P`- Pg x0  0, 0$00(01PY0`X0,0\0 R $000`tRcK ,0P 㘎2 QP1@ R  * Pd " =T @ P,   +0S0 S0S,  )`%D0S "0S   $00 0$0L h Cp Pl@0 0 03?4Ѝ蝘ֶ'VoOOOOO)ERA-P`@pP)  p0U P00 ^p Ħ   8US U 0*p*p0Sl荷O0@-P0@M 0$ 000 aP  8P R 0xЍ0@-@?=@:񻄀@-pMPဎ@Pᵏ`T 0╏P!( , o@ЍM-P`UT pZPP@B<@5P  n0s oVS* ppPpJ%0*0pPp -8?? 0 |-? h  ዒP HP<``fЍSfo輄OE-4MP@QH0 000$00PU+PPD0S" "0S,0( ,0S (@ԍP >&0, 3?Sx0@3?0P\0SXP0SD2L 0P PP P5 Z000Pq $0P 㹌S@A4P BP |50Sp0Sd@xPP1 P Z 0(00$ ,00 00d0$0h0(00l᫈P@L  Cp PP 5_UU2/ 0S@@U@#T P_4Ѝ`S"OWsOڽ7ƽʽ/p@-P@`PPpp 2/5n P0S 0S 2?0gn 8o`pp׾A-p#p`Pᤇ@P 0hS @@A-p:p`P዇@P 0hS ֋@@@-@0 幎o`Ѝ@-@00 孎P 0S03?0Ѝ+8@-@PἎP8 8@5@-@0$ 収P gЍR@-@0$ 倎P ^Ѝ=@-@0$ qP UЍ}@-@0$ bP LЍB@-@0 SP03?0Ѝd@-@0 EP03?0ЍN7@-@P0$ 6P00 Ѝ0T@-@0 'o`Ѝ̈́7@-@P0$ P00 Ѝ0aE-`MPp4  @P= 0!0 X@ T  0 @T 0T0@d}X `x P 8p ЍYjiwTJvĿ@-$MP `@pTW PL pDW @  3  h) 07pH W $0(W  0SS0C  S00S   00CS   0 CSR pTW (00CS W 00 ⋋P`#0S S zpƅ ᨅP x0 t庅l ᜅPX0 $Ѝ׿c̄꿄)[| P LD 04 P , Ѝ׿c̄~„R„ƽ„A- @`PU  \PU  5x"Pʍ` \M`pp& qPP,pP>0SS Y p0 & 0Ί P yPP APp0SS / (P0H` EЍ„„c̄„5c„„r„Äp@-@L `PT 86P / p+p„1Äi[O8@-0PH@P PB88M- M@00R0p0pSHPD000D00CS,$,da 'PeRW $ Pk  ᫉D0S0nH0    ᗉpZ4`   mP k؟ ԟ  5PkʟD0S   >P\ ḟD  $D0P S  00  0 00#P @@  rk⑟iS0቟  0vP ^hD0S嗇P pEpL0S2   >L0P S)(? `]5S0S 0D 1PR@ S@#@2T #  ᲂ 7P0 T00Sp0S  D0S0 | ЍZÄRÄÄÄÄÄÄĄ3ĄKĄaĄĄĄĄĄ0@-1M!S  ! ! !0@0A0S00 S B27701: BQAA@U0S:S B27701: Ѝ00/%%s%w%/P @-p@`4@T,Dᕁ4PDP@/ȡP/8@-<P@P < 8@-@P 004 T40 408 ȡ04 4 8 /ȡ-DM@< ́D &1000$0,0(0(000$0,0]$DЍ䗚要𦁀8@-@P;00CSܨ쨁 䨁XT P LHD@<8 ,8@#ńńńfń$ń(ńۄ,ń1ń9ńP& M-@Pp `V  @ P;/@P ?oUZ2 S:/P/ 0Si @-@MQ꼪l E0 0Z0T00D@Z E0,C(A$Ѝ@ 0S  Q$@HHH,H8PU @T 4 @5C% 2l!b1`!XЍLЍ@nƄ_ńńńńńńƄƄƄ(Ƅ/Ƅ>ƄCƄTJLƄƄ@-@P0 P000@-@0S S 4@ @ @9ƄƄƄ@-P0S S`M-`.8@Pp _0f@ p  |00SP T  n00S  \  P 0S( PЍƄƄ"DŽM-M`@PpP p,pppLp PpV`P pP pP :P` p  fp  |PZ R P  00S0   RZ  7 R _oRZPU`X2XŸ0S 00\0<Ÿ \ 0\ 0!Ƞ Ƞ\ 00 ,PLP PPz zP`   PP(  CMUP L RPL RUx `V  PU x *,@ P   R  P P !PQ   pЍ:DŽADŽNDŽYDŽtDŽyDŽDŽDŽ̪DŽDŽ Ȅ+Ȅ1US1S10/@- @<6~P R( ~P /Z`ȄM-(M0 ?0d?0@0 MpW@?@0̄Q̄\̄M-Mp@`[Pᛕ0UT 0 Ðw ?p?p@pMGp?pp K 0)P TT  B 0P 0$C P0T  D @DC P 0! " ȁ#)( $* (+ ̂  a  ,t 00X e{oLP  ,| KuɄ7n˄˄˄iw0H-P@ d D ?@?@@@M?0?@0 h/D 0 Q0//DA 0 h0 88Sp/D 0@-0bMS 0 x@P x6dPC p@p 0W:X v0 H #yvu 000 l0 vP uP uP P uP  0pp@ 8004 00Ѝ8D̈́GI:̈́n̈́7:%΄HC\΄a΄~΄':΄$p@-`l@P\L X0Xpu PP@P $S 0$p΄n̈́9΄ τ@-@(M000AЍ@-@( M 0A Ѝs@-\uX0@Pp@Dp0U (`,0 pp@p@DЍpDτ$\τ0/84 0p0CpR Q p0//$@-P,M@pP` P4! , (CA !U U U:111LP@zU Cu0 7z00,0 3w 0 8 ,w@0`0<0X080\0000<Ѝ9҄A҄h၀A-P0M @XpBpQGqcipepd㨍`Q㣍QQ00 mt$14@ 㐍0Ѝp@-P`=@Ⴭ`5{`<-<s7m Tn![Tm!@b0PR00000! T@b @0 @p@Q0040$  0000040/PD`x 40l0 $ 4 4 H@ ,4 ,  H4  DH4 /PDP@-/҄0PR e?>/s ҄ӄP/@-@PP 2 1 R 4 O?N?0H"@-@P < 2 !0S41@D4AH"A-@PL0r@ `Q0!S41D4AH"@-/@-H0H@H 0dC1P0P ,@ ,/..-ӄ||00lxC1P/!p@-@xP`x 6/ px0 0xPx@p.,/.x/x p@-P@ 00b C1T :|GPx 0SPx@x PUx`x0 p.,/.-ӄ@-黷@p@-Px@x0p@/A-px`Pz@xw 0 004/ЍA-px`Pg @xd 0 004/Ѝ8@-PxW@T xR@xO4/ @ xGTPP8@-x?0 xQP P P $@-// /ZӄHHDE-p$`0@V -@PDP"P !0@@P@ Z Pd`XuP [t0;;9:02t?3nӄlӄp@-`$@_02qqQ PU:DqUap02pӄp@-P$O`0qq<0S@T*T E$B02pӄ Ԅ@-$h@2s0S 2 qM-`$@ $pUTWXdT^ 0S  x VPPQ0s09{漺H1A:T, P  @$6P  @D :4s00帲  00帲Th zP@p@ Oj@T*TP@}02EԄ^ԄwԄԄԄԄ+Մ`ՄՄՄՄM-`$@(,pTW X T\ 0S|}VP PQt09{T㼺" H1:P0( $" P  j/T  @D!:"r  02Ἲwpy0@:P $M@P   0s00B 0@2@02Ѝք6քNքmքքքք3ׄp@-`$@Pt@:Ps0T@%PJ0:0   R$X @t@To<:o(0:@02pׄM-`$P@:s0  0P :o01o9:)pr  X HX$ЍMopP ЍM0:oy027PP( $[uP9;:s0 *+㼻 {o 0s 㼻uo 㼻qoX0s0 ; 0io 00 ;do[PЍׄׄ000S//@-Q" (((('(('@'t0pd 0ۈ m00Ѝ/@-@P000S @//000/@-@ Mo   @P}o Ѝ8@-00P00R@0 (!D0 "00 0 10 P 0(18-4M,0  100000 004Ѝp@- M 0`000@5P8 0 P   , R\  R PPU Jn@T*,Tڀ Ѝp@!؄7؄@-$ M$ 0@000sP Ѝ$ @  -$M0 000`$Ѝ/< @-0S Q 0耢S؄M-`R0M PP Qw<dPp00W!1[  !́ 01͑Rd    d     @P@[ !   @ P 4B @ Td0pW*0Ѝl؄؄8@-@PP ^0 0 jP Tp88@8p@-`P@P _0S ^0S0{pP_Pppp؄@-@P00 0S @/  Q !Q % 5kM-YM<` 0@3D 0@0PPH LWm035 8D00@0P{ 0< H0#85 030@058D0PUb H0L\P T<0@D HS\ \  `V/ 1Xx 00P 00NP 0R 0R 0R 0R `kP1$ 10$0$0 11`0`d1P!0tS p00R0!P PR  0( R  0!((R  0 000Pi0O 05}oP0L SSsW#< ooT0BS*S8hoYލ4! ؄)  L+@x} u̪؄ل P/8@-0S1 0S. 0S+ 0S( 0S% @PIP8| 0000,0000@P000H01@01<0100,0 0 88dA- M@P 000S00 R3/PPPPTPP~000_P 20 S10 000P0S1 0ԁo7p 0p0 nPP))00000 |10 0R 1 0[PPrj0S`V* V ,! (0S?Q0,B0 5:P0u(`A$a OPP (1S  FPP(1SPPUu `0S|00Z0SdUu0%1 U 0 0 0000 Ѝ:لhPلyل0S80@-@$M؃%1S<pP,$1S9P0 $ÃP PẃP di(1S8 00(0S?005000%1/$Ѝ0@-_@P ,//@-`LP@pT 08 0S @@ꀢل^TJ0/d8@- \@PX0@@ Pᩃ,PU &1S P8耢d0p@-@0S S,0 0,0 ,0 0,0(10 0,0(10(1 `VP PPP,1808,1,1<S00uPP,Q#P,1ePp@r,10,1pظلU90(Pz/0$Ps/8@-@PiP8P~P8p@-P@,10,1, ` `,1܂fPp,1 ӂfP p@&pل8E-p0`@P$1 㻂eP`E 0!峂P01S 㭂eP0!((03SP h0P XXXWVV 0SS"P< 00 08<1V0P01h0\ Qx0QthPPHU  v  0010 1 010101 0V! 04 0 pP W`1l#`pf 010016W 804jPTTX  5   01 0010U !  0 pP W`1l#` pf  01 001 01001W 0jPlpX    010010U  !لڄ9Jڄjڄ9%98@-@,00,0 ρP01ʁePT 001 P01eP8@,00,08ڄڄ88@-0@000奁P0eP,14,1喁P,1 㐁eP8;(1@14@1,0<,0,1808,1,1<0;0,1tP,1oeP<,10,1(1<(1 0418ڄڄ8ل30A-p,P`\@P2 W W000B$>0V`00000'0 000( P00X0 P0P00?0Lo`HHڄڄڄL"0-1uM-(MPP@X l@ QQ 0 d 000 0COpW8*l0`g V`!0S0B00h Q # !$00@P  0@P   &001000@P 8T @pP (Ѝ ۄhۄM-0M@`ePJhOPp0 0WP1P!XU U  0010S Ph000h0@000@P U  0@100PH P\h0 pW@ᓬ*0Ѝl؄zۄ؄@-$@` Tp P0000~ P T 0 0 0 Ѝ@q Ѝ@-0000 Ѝ@- l 00Ѝ@- ЍA- PPdm P 0P 4`~ p 0 t 0c0Sl  "Qr R0SS `4v@Pb 0M XP00$02,02 002(0VGpGW P00S 00 01 0P ~P:ЍE-SP`pC}N P0P(0  00P@P  ЍE-p`M@P~Q~Q00hU $8 0$40 0@P@PfЍM-Mp 0P0`0kV* ~0f aQ@!0@10S T@!%80%40 0@  0PPP`Ѝ@-pP`@ P  0 00%@PG  Ѝ@-0  a Ѝ0@-MP @P0 0  0 PMЍ0@-05  a ЍM-$0PpS @P@ 000R $ c00 0F * @@t@P " 0Ġ00Z `'8pfg0 V'40 `! 0` ~0Pp f  0\ 0Ѝ<0P P L80/ 048<00/0@-MP@ 0TX 0 @Ѝ00@-MP@ 0T X 0  @Ѝ0A-MpP@` 0TX 0 (2c# 130 RrcP @Ѝ040080 < ! /  &A-pᜀ@ePPU` 00S cl e@:0@T 0P qc(m p/舢^݄  $A-`ጀPe@@T|p 00S Rc\q!e@! :0@T 00S @c_/ሢ^݄`\ -<S<0` 0  00S 0 0 0P00 /@-^ S\@@R00 0 R  00 0`00` 7@-<@dP 0P @|s 5 Ѝ0A-@ 0@00< ; ;@0 0S s04 000M @ @ @ @  40,= B83$ @0@0<0tl0  00 0  0 /E-P 0@p##,` 0##40#"40= ``FcJ 0 R !( P0 2#0+ Q Qؗ  8 0#(000S0p1!4p1"40P  -M-0 @0p##,P0 "400#000= PPES0  a#"080 GS/ !( `V0 2#0% S!4!0 Q,<Q8<00 Ѝ-M- 0@p P##,`00 0##40#"40 0m0Ccp! 0 PD ,( R0 2#0$ [ [〰ؗ 8,(  R0 2#0L  [ 8[<80 p2"4p 2#000P .-M-p `P @0FS@LsQEZ#0 ",`  "4 #000f@+ 0 @2"4@ 2#000 cs  00 @ 0M:R  0MsS  0MM-p@ܡP @D 0Sn 0Sh``e 0eSa0-SV0Q * V" 7-XP V V0sS I0bSsSD X0P0 C R RnStS4@R000-1S*:000# R 3 "R" 00S000C S \0000S  00V 1@S@0000 @ @D蔢0 0C R 0 0C0 /ᔢR A-PBp@Q `V Xpf@h/SRp@-@P` X F Pp 0Sp   S$  0,, p/@-0PQ 0#40pW P 0SpPW`~P@1~@# :X P00p0S, s0" Q 0 R3?0Q6\?3 s0R?0 +r  R:0#4 0F@0Q00C?o2 # T0 0C \ R1  0 0C/@-@0S 0@\ S \/8@-,P 0S(@ \000S 3/ ,0S 3/4@ 04@D4 (0R0008踢8@-l0,P00S 3/ 0S(@ 000800S 3/4@ 04@D4 (0R긢@-@@P`pP 0S !PE-p,` PU #0 #\ 0 0PSP 4A3/ Q 0 0PSP 3/0T@T Dh 0@0S 3/0S 0 03/0,00Wp78@-@P 0 0S 3/8p@-P@P> T0P,@T0X0003/P`+ @=0 R#  0@:00 `\  R 2/I0 03/`P D0@ 0W01G0p `dp p$P0A-P\0<@<`p^VP0A/@T..0p@-P(@`4@D04 (0R $0S 3/<`4@4@D00p@-,@ 0S 000S@/ḢM-`0,p@d0PD0t 00 070:00p0`@P񟗔U[ZYT[ZS+@\ 񟗇UPVW[[UPViV@ QvV@ 00B00C00D00E00F00G00M V0 01 #0PT@{00C?o20#S000 @D 0S 0S10D [Ap 0       ,,  R   R rPk l(4J4 R 0 S R   [PY k4g[{00#$ MV1!0K @9 ,U000P T@ @D 0S P 0(4J4 R P 004 @ @D0  $ 0SS  p0P0Tp0 0 PP (4J40 S  p pG 0S 0PP  0 P4S 0S [0T@: @D R  R @/00  @P"  ^A R ^  !<"<  0;/0 P pXQd00Sn 3/kS8 0 S00/S0T 0SQs14Po [ 0Sj 03/JST 0SQZ14PV [ ;/PP020S :S!0@ A 0@(D4@ 0 <  44@4 R 00P14P (0S P 0S ЍM/[[ 00 00 003/P0 0p[!^ Ѝ$P8@-@0S) $0S& ,04 (, P804 0S 3/P804 0 04080010 R010108 R0108800 S14000•/@-^) \ T0$ 0C @R @T 0X0@ PXp$0 (00p(0,0 P400A Ѝ49dᄀᄀ8@-P,@ Q 0 03/00Q 0 03/00(Q 0 03/0(0,Q 0 03/0,000,08A-P``@p0P0800000T0A 0/ᄀp@-`$0PS" 0S 003/PP x0000l0@ `00 003/P (0 @p ppģm4 000@ 0Cs0D/70Cs/6;E-PP@pD0.S:SPp` WP 00 0 00 08@- 0@gshs/ls- )Ks$ S%0P $PD00D0\00\000`0$0`$$0%0CS40 040<00<0`00`0D00D00 8M-DqP@(`TAT , @P l)16P0 0P0,  ,O P0000 00 0000)jQPP00iP k p003/0S iP@/T ᄀ9ᄀ$ḷᄀ 0S/@-@<0S 003/(Q 0 03/0(0 0S 003/,Q 0 03/0,0$0S 003/01009 0,p@-@`P0S1!10@ 00@0 1Q!0$@03/PP)003/PP# 003/PP003/P( 003/P,P (0 03/Z&P0iUP 003/`$`003/003/` `0 0d\ `T0P i 8pA!8!!!!Y"$℀ᄀh9dp@-@P:` R00@dT   0 0 0 00 0 @@0SPU U`:`ЍpP)0p@-@0Sp0  D01000S 3/0,P 020p@NO℀ᄀ9!s@-P@! 0P`@0@!@M@h`0 00P0000a3/@P ,0(( 06㯼Ѝp oK9w℀ᄀ8@-XP0S L@,0S @ ^,00 )0厼8 ℀ᄀ9M-P0 4P,pT `t$  Rz{{{{{$x{TzPylz0S%4 CR`xx(y{{xxxW@@ Wl@ @ MSsD3@uPo0 U@#*US#P30#P30 ,0 @Pʥu *@Pt@W@10S (U :U000 UP@ @U 00Sk d3/h,2@0@0S 3/0S "S0!1 P0! 0 @ݻJ0S0 \ RXS   QQOP#0#Q0 @@, !R@ =  WUPPSPU5$1@0 R.US0PP#1' @P"  M00 @TT@0go 00 0003/@P0 0^@Ѝlv !!!"d"("""d{℀℀@℀l l@-`@puLTP P@D"@1 L00M-PM=L8LPtD0pp$p 00 0%000 0]0 0[0 0BQ@2 <84Q ( 4Q  00U`P30D8#`HpP pBP 3  #00#001000S 3/L3h0X8@#T3  L  DCD 30` ,3p 2 3 2 3 0000 +L0  ^^FFFS03p3#^! pWp.p.p~W qS0fv``>F315s000-H0=\900& pWp.p.p~WqS0fv``>F315s00 0S?  00-0S0 S00000480E0D0/4 $0R0 . R( ,!p//(0-,#!0|>0.0S 0s000000U000;//0P10@//@- 900#a40S0sp-0S=@$013$ PbS$0s@0 s$0@0$@00@-@@FP00,00@90ᑶE-p@`PH {FV<0$,`(P.<0@0 p1S X000 [KV   @01\00M0XV&^~o0010000 P P0 UL儀!t!0PS#Q +30@Q0s0@000/8@-@EP,0(00(0,0 0ss0 E0003/EP8E-09@ q0s`1S@@&NO40尃S P $ 0帀Rx*0b$X!01 z$0 0$00D00$ 0R 3S EQP0 0P <@-(0L(^ S (0(0CS(0g \E@/( 8@-@,0<\(\0s0@@000 0s000ssJ00  !980S `@-0(, -@#T18  <0S Q(0C S0.0S 00s0S(Q0 D . R Qr 0    r  Qr `    E@T oSQ  QP8@-8 R 0 ( R4$r ,9.84\ @@(0===vpS0US 1US  01US H 0`P=0=00S 3/!"A@-7 @=3==0= @///QP# (0-<<!P- AqQ  r - /0A-TRU(pU0@$`{( `c@V @`#v0@V00$ S0U0= 00!`Q`0]0 0S`QP0p@-@@p( r4 $@ .84\ D\R  r r 1 `      <QE (A00R0Sv YsRw :RN t00CSnp|,Pd =0)=Sb0_#4S S S0 TS S0 MS S0 G000 0@0== 0=5=6 0=`00`0,=0+=( 0=!0@S 0S0@"q@#Q?&>!40S Q000 0s000000000S 0 Q ;0`: R70S  :S .=>/= 800 L J 0S   0C"C"C &./S4 R \0 000 0s00S00*S >S007 0 3/P-0 000== #凰 000= `0V Q#f= 0Ѝ儀:D{儀儀"A 愀"愀E-Q ^A3N NNZLL|~`pW1p W+ pp pWp,"W :WcVabVa bpVpacVa M P Y0"-Q!10S$%*0s0 00  Q00S !*0s000Q0$0%*/0"-Q!10S%$*0s0 00  Q00S! *0s0Q0%0$*/1 @-{@5 00,A8@-A`0= 00s000 0 _00=0-=`0Rs0P RP0S=0=00S 3/`P80@-@ 0S 3/1 ` 000S@/1M-PA``T v` @@ -@A --  r  w0  @1p{pW  [x @pp`v`pW  Vx y@pPb M-`Mp PC@PT >11n?1 1=11= L4Q=0Q1 0S{0 Q'4 E S0B0@q 0=0= 0=0!00S 3/PP1S 0 0S 3/1 4 ` q004` P`$4uP{? 4?= 0==03= 4y?=0= 4q?=0= 4i?=V0=0=匮6g/xs00l#  d S%S0D?@  1 -01=0D >PU3 RLXdp| R R RRRR0 "0ZB .` R\ s0斲!  0PR`- v`V P`1m]ZP]^`c`C&P""U"~uP PPP~_` V*0s0. R0! 1SP U:QU {/!P00S 3/P$U'P  p0B"S 08qXY1PQ01=0CS0=ą]4PPЍ/W}愀7n愀v愀愀愀愀愀愀"A~愀$6$x$""#Z$T$愀 0)!), )/M-w@ҳP`< 0> >0[ `a 0$0(0   (0,0  007;< 0030008 r P 0Ѝ@$Lp@-Pl ` @P?C PVp13/ 09S@T jP pp|*焀@-00 @0 0$9S000Ѝ@<@-@0 0Ѝ@@-0000 0 0zЍ8@-PPY0A?3` 0S80000>00013/00`0@00( 00- - 08 O焀<|@-$0PӬK O焀@-(0Q 1S @/耦p@-PP 0S0S 0S|寬pp`Pd姬p7  M@PD07 3/@P$ᔬppl焀|焀焀焀0@-S@ 4 7 3/0S  7 3/耦@-0S S @ @N耦 A-p@`0 P7>`VuP R00焀@-pPc@t@ @@@`Vt@  @;$>焀M-R(MPq 0 \L0 `00&0S010000 0 ,0 (  0c 00S 0S 000 S 0S0$ 0o0 P {?B0@0`~ Vr q $ 0$ Z' 0p 2 #q  0e 0-"!" #  $V& . V"~/ & R-@ V" 0~/%W0p@ 0p(  B%r ! ! -  &0S =@ 0 V%~_0R1! 0 S1!qQ  b10|2Sc 1S0 0s0     0s0 0+V#1 0V# 1   0 c"E0 0 0=1"   0"V#<  #0$  0 V#. ! ~?(00C" 05s0000V# " 0' l032& <0R:0@!0t@0S 0/@Jt0 0V%!0100S&0S04020 0 0S 0S  00 00(Ѝ焀:脀:E-P $@Sp0@& ss` B0R% Wo '   , ,lr  .l %  080 S 3/0% 0S@W1  ( P 03/00 ) P 03/p 0S 0W 00$0 0S0  &0SLL0S` 0`00 00冫@T @TE}%0S EM-P B{!T 0 @T@D@001q``Spp pP~pT0T0 u 0s0q00T 0p0_-$ eRVS r S' S6, (0 0aV !1{QJ0305,02,S-(0[%:)0 $ R01ŵ ! ,0(``cV`!V v  ,0`,`=.өR 1S 00 0`0 (0S`0B0 !0p 01 0F0 L;;脀;T脀M-0 0{rWP 0 PUPEP1U@0t@\ U`v`V K` BM $@10HH!/0@ @ 00!000 P :( S@ ^ c000sq V`^ 0` ,00ЍMs "P@! @1  t-0@00m`Ѝ0M-`p0Ա{ 2S@ @T@D@PTuP0 0@ r Rb a & R  "/R 0S1nS !SPEP H 0 0s0M   srM PPPr&uPP0h#> 000s00E001S S  Pu  @ l $l  !100h(!R B Mw0F0   sr 00M0(h# Rp0lP J,00 S,0 \PsPPU PspS0#02Sx00q0Zs0 / ] 0!0Us0L0l00U00 0o脀);M-P`(Mp=S = 0 00S048@P 0  0p00 0 0000%0 042  & (Q R  S020000'00S4"0 02Q0 Q0@0R 0 R0  00S0S030S0#!0=& 0$9S" 0#01 0 0S$9$Q Q$p Z Pq$!4#00S @Ԩ P0@R 0q.{?p =ʠ $0000$\8 Q$\* P' Ql \ ^  oR^  0 z Z8ZZ0  sR`Qn/-QP1 P!  c#{?P0@  Y` 0 Ybo   @(Ѝ=!08801<0//8@-Q1!;10S 0@S 3/$0!1060$88͂@-10S 3/p@-!a0PU88#80w/u000P4@  TA4@S1< kUT@@P@T0$0p@-̦脀//////(0 P  $PH//$@-@ 03/00s@-0P0 0岷Pt@h`U 0SU P0S 043/P ,0  $0$@TЍp$0%8@-P(@ 03/00P8(0@-@03/@(0@-@03/@@-Pl0`@p 0 XP XH X@@< +(p(K넀섀 섀„섀M-MP@( ,0 2 P 0M0$0 2 1 0` /R R 0(  /1pP 0/S00 $0S UoK$0K@8 +Pf pd $0SQ!000S 0 S2 S?>W5*0@0  @c0P 40`d p 0P0pS S  4  0 jP `d0\00 0 S2 S?>\*@Ѝ@- 10SP@@pʠ`P  P@*@ -1 S@@$@ 000-0P Sl -@`P -P 0 8 -P0@0 턀"턀+턀Q/A-@M`-PPA  , p 0gS0 0Cs00.,P0gPc``EPU J-0  S U @- =-~00100V  `` @/- 00V (-܍6;0- ^0 S0 ^ 0 S0 ^ 0SE-Q@@ T(p`."PU *T 00S @D Pt@Q dP SB` PE P0@ 0  0S  S00 ,%0 S2 S?>Q1l hP `T 00S@D `t@@ T @D g Ѝ4턀p@-@1` PP p@PP 0 S" S/PPp1P!@,0Pp G턀 M-Mi@ Ph,L 00`P 7 `8pRt (  L R07 RP0Px0*0s0Xu0x漅5ᖣ#`0 zᖣ&y0F`@0d0(PH L0 ( SnP+P`` +?`02FQ`0Xc7F5H 'P el7|g%0S*X `D7 0 ,7z @x Z㿀  X<"0tS *X@ QlH 0xZe 6HGPL0 S2 S?>Q"R`6Ht&5`ƟP 0FX R@H 0x X Hj 0Y0 Kj 0 O0P @   B!R R !j00X` hp% T+0`h` `0cS0S7 *P j*P  `5$ bR 000Q ,+V&GL0 S ZZ20HL0 S" S/ Z:L4`,Z* S2 S?>Z:!L0HA SP1HPHPH#PHH @9zZce j"*P3 0*0  P% R P  QQ Q   /o" R B Q   R  R|  0 @ A[ !b%Q\ 0g* K0 | 0C0p! b5RL`HP`VDΘ1 H =P  Ę'L0 Sa&8P1 0 0H 0@PᮘH]P  H5| P 團pH廙Z  l哘H00Hߍ  h턀4턀 턀턀턀턀턀 xH-0x P?0?0@0M?@)?@ LP 0`0T *`P6< )P R( )PKx *Z`ȄM-M@D d (00P$0d Q`p0;w0h00$0h00hP:2%60d\:v`pP gV D  QpE0xp0 0pECpxp@0|0嘜P` 0@/T\T@@ (1S*R 00〹:P>0HC>0/S\S 00:$000`?@0V 0 p 0d0( SPH00 0WS,0  0 p0 07 @G R:mG W,0  R@ 0W`000(,:,S!0W  *0S  +S *R  0v0@:S0pP+ N:S0W0 S `/ [S D 0RB(P =(P0S 0L ?000ud0` S7Vi`<&W`0@Sx 00 %p0VP 0c`S030#SO :S!  80*R00Svp0d0`I S908@?07`%}PU '7 R* 00R 0=0SZ =W\4W_ 4'Pm@ J(T 0S0S0S  0P00000 0/R\R :S 0R000SC@A 0`\$00,W, 0`  0S+  W<  70pP P?0 0 `4/ n40S 4 0d T'P P 00 0g`bP@@Q d0 S2 S?>TJ:0@#:S@@@$@d0rD:S@d0P S'w1a8$00S:@(0S 0(0UP!$0O`0X` P`d0 S2 S>0V*gPhS@( U`@1@! 0P @ZPd@h  j'UR 0`0 0P`Id0 S2 S?>V@*X`*0@SP4d0 S2 S?>P+*`  0DP@! `  0;P 0`@0 0PhP夕 d0 S2 S?>Z* `巖000p0ލ脧 X4턀@-0  00 Ѝ@-pMA0S, j000CSTdlt|\ L0H[0 @P l>@  &P& @+@2pЍ ńńfń$ń(ńۄ*0 @-0 0 Ѝ@-0 0 Ѝ@-@p`P( 0 Ѝ?0 8@- Pp@ 8脀/p@-@`Pڔ p@KM-@`\WPLUTr:@nL Ti:@B p Pps @PP^@.K@nD@3@#^@3TP@lTI@@L@@LLPPPNP,*@^b^ l P2:dPP):Pp^PP XPP%TPP W@TpGTW@ T T L PLL*LN.A^P @LpPPlP:n@P:U U@T*?^@^QPAE@REp3p#Tp3WplPW*^ TtD dPPQP@D$A@2^PU TD dpPQp@D$A @d TID}@.N@3@#^@3T@lT{P @P1TP#P3 TP#UqPlpUi:^8 PdU5PNpXTpPp\P%xpUTP'tppPWJWZpX TW PW \PH%UTHPH+HN.qQ^P@ pLPPUP p@@@UT@@ dpPUQ P bP b : b b bM-pT Q @ T H % Q2"% Q 2" `\-*0@8<@0@D`h`$ 0 P\8<P\0P\T?o2U0S T  0 @&P  0T` dЍA  0L BM-08MP00#03\00ST000C a00 04@0C8$LLA(P , (N0,X<ND0 4Q@ Ġ , A @^;l@    Q5 20 2nΠL : Q`@ 0@ aA粀:n @pQ *`pW "`5 20p2 >dd`F`$`@nV\(@dT,ßpW  Tpd'* dp^.pW*4ppdp@h T!* dW0@ T* d@ppSf@ Tpd* dp^0\00L00000\_ `\0`X ,fL0V@CHp`0`d0`0S00 SVp0.0``V00, 0(@  d`F ``qA粀I @  N @a@  | SR1: l A b   0c<008<8ЍM-M`@ Q@\ QA@@Q^'\^ @ 0Q @@P@T \*P@@ppp@wJPUT OoB^@T@F`Pp@PP@ⲀTPPP@PDU @T p@rTⰢDpPPP PTC, , H# DC( @# $  (`$`, P e/oE"4 Z  R J`0 P <@TPD   @PDU@Dt@DET: Q@@`t@@@P@,@U(@P@@$@P@P`@@@``Fp@H@@` `8@@2@@gA@`P`D``8`@ ``V `P@AD @Q5 @0@P @U @P` @`t@` `V*``pfW`>,?l@@@4C R 01 VW^ 0pGV`0U00S ` , 0,0t0-000'0 0S0 p%.:Q ?0000S%R$ 00S`F?  `3 0 04 00PW 0pGV`Vu0PS X? P? 0SU$   , ,P%T-Pg`0P0W 0pGV`V 0SP0  , %4,P-0%8%\.0/PH`0P0W 0pGV`V 0Su  %$ 0  , ,P%T-P*`0P00+ VW  pGV` @PRP<P , ,P%T-P P 0S `000 % @ W1!Z 0S P 0 bQ  b 30    @0pj j@@0Sj0@0000;# Wa K R P @0 S 2@ 57\Z:0    $$\pj  ? R00@0000:# W3 K R $P @0( S 2@ 57\Z:0    $$\pj   R$0000  VW  pGV`!U,;`P R4,0000 ^4W 0pGV`V%<,%4<\0TP4PP` 00 0S 0p 0 008P<`b0040 00« 0S 0S 0`5S0W 0pGV`V0P00S0 S S9 0L0 0T09P00X009000%Q`F0`5SVW 0pGV`%8u <#0#RX9P`0P@ 0@0S` R!1Z!Zs  pj' 0 0j 00 00@0j@Wa 0pGV` V0"0U% \ !QSd0%W0``F0p8h000\ h0S*VW= pGV`h$0`F0Q0 h0Sh00800 S>l0pL0 0T0T00/>0l00P070h000`dh Rn*TL0A$0$0 0SW 0pGV`\V*W pGV`5S`c0 h0\V*W pGV`R5S`c, 0%Q`F"\V*W pGV`5SQ W pGV`V:5S S c ` R5000Q:h0 h 00S l/΄S>l0pL0 0T0T0 0$9$0P0T5J`l08P00X0X0 0d '0P05900f 1WR0p 0 8P<` 0p008P<` 0T0L 01 岠RWC 0pGV`S  03$0$00311 \W) 0pGV`5Q`aS5R`b@0  0@30H000H0S V*W   pGV` `c@ 5S @ 00X0P01 RW 0pGV` 03$0$00311 ^W 0pGV`5Q`a@5R`b20DH000H0S V*W  pGV` `cD 5S D  ,00 0bD R2v00 0S 0  bD0S  c@0 0b0 4S0b(  c @S0! S0!c @c@AR 00@0S0I 0Sv  @00 00C 000000SJ VWd 0pGV`0  b0R00000 0S0b 40S%<,%4<00,4 S \0000 00.B[.-o6(= 0`P0000S 0S VW 0pGV`0Uh0`P000000p 0 00(08PS<`0SJ0 SF P40S (0S$ 00!,0( $ 0(3/P400i`0( `fV: 4b000004 c Vfp1p! t`V  4fm0`(0,0 00( 000S,00`Sp0,p5`0P`f0Pe0000000000US 0 Se 40< S@000 R  0,00 0SQ 0S/0Ѝ-00 `R #$" 4"s0`+;ᬊE-@1DMp$00 ``(0<0dPhP u0p0e00F?o2P0S 0 0R0S \Y q0 l  e gyDЍCC7@-\    @ Č @PU @PU\:$ Ѝ0(@-`Pp0S @@@@3/P  dMM-PU 0S \ `p^ @ 0ST6 T8 @pQ@A006 0@E^*` p` `W( `pZ$ S/U1t  Q5@D2 55:A 0PPQ5 51`b ` 0 ` `X*   @Ѝ0 0 0 X0\0P T0/A-0PPp@S` XpT@@Q\0S) npaoo1 r 0 E V0*X`P\TP \0XW 0\ b\  aPX0c\ALPH@- 0S @ Q*T*S1#0M-pPg`EP Q [/@T-:S@ X(*@@#T@f@f AT:@f @X  T R  00 P G` g PKPEЍp@-`P@P pu0/@- Q0$0480M-0M 9 00 P "   "ȟ0 H <   "  " lʃ (  # . @  , @ " @b% @ ``H@0 @.@ @$0@<@`8H@ @"@@$@lʃ@`H@@# @@$G@ @,@@$ @b%@`G@0 @.@ @$0$@<@`G@ @"@@$(@lʃ @)KDO@D@# @@$,@$@$`PG@0` @,@@$ 4G@b%0 @.@ @$04@<(@(pG@8p @"@@$F@lʃ@# @@$<@ ,! b%0" !0= #$!p˃,!Pa ! . 4b&0"  .0= # .˃,.a ! . b&0" .0= #.|˃,.\a !( . "!$ʃ# !pln ,! $ .0! 04c> "! ğ #, nȁ( ! . # 0 , "0# c> . "#   # "# lȁ ! "x# 0 , "0c.X30 0.0#D30 0"0#,30lȁ0! 0#300  "0  c=" *   ra̢  " ȁppp"p' 0 ` r "0 c=  h"*   a` H " @ȁppp "p' 0  "q0!c= *  @ԡa  "( ȁppp!p' @0$ @q @$ 0 c=  "h!a  ,  ȁpp .0000 0 0ЍxjVνp $|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"amD꾤 8K`Kp~('09|eVD")*C#9 Y[e]},O~oNC5:~Sӆ*A-P@p`10SA050205T0>0 @@dR: pI`dR@?Xh @ @H8B?? A0p@-1@ `? cRP7 c `#8 V0P00T0 wX p@@A-@pdXM`0`\ \ 000T *PdU P!@ }낣 XЍ#EgܺvT2s@-@P `PT  Tp0T @0S@`V5ЍpRQ/M-@A⼰K@@@ T:` PdP  03/ P R: Z\ P*@fK@Ѝ諪XM-XM0p8 <pP0 400`@8< 0 40 08< P0 PT 08<0t08<`0d08 < 008 < 0 4$00 08<0480!08<# 0" %0$ 8<' 0& 4(0)0( 8<+ 0* 4,0-0, 8 4000H00H 0P000000L000T0T ? -L!PL. P bL !H ,@  @H ͌b!"n @. @ @$l @,@ @$ `@- @ @a @$$@@ @!@b!@$8@͌@@"@n@$@@. @ @$l(@@ @,@`@$ ,@-@ @ @a @$0@@ @!@b!@$4@͌@@"@n@$@ @@. @l@$ @@ @,@`@$@ M   a " % +P%+/  ( ! dA " ͌ ' " "/   $ n ", P% P%/  P* . l "0 P% P% , `_ "0@$0 @#40`-@$0@$1? 07R# 8 bx b##!<0!80!40  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#4000 Ѝ0AA-`M@`p`T *PdUP!@ R`ЍM-hM0`8 < 0O 4008<`0`d 08 < 0 08< 0 400 8< 0 4 008< 0 4$008< 0 4(008 < 0 4,0!0 8 <# 0" 400%0$8 <' 0& 440)0(8 <+ 0* 480-0,8 4000 0P00\00`0000T0 0TX0$0@d00c#%"<" X0@#0@X0@$0@` 0P \ P @ lAF$lK$@,-@X0 P T0 0#T 00# a..0 d.\ d. T<Pp"0 0! 0bà,, P0 PPn,0n,p X\p'PPc pP l l {pp#pp'pe!! p pp`!@`!$p਋ %(d#%","p a!&"a+" \ (p0$(n35#<#p0b16# b;#0,0{pPp. pp'Plsu'|'pPcQV%c[%P0Pzp@p,pp'@`su'|'p@eAF$eK$@4@Xzp p p p'asu'|'p d.d.8zp p!pp'bsu'|'p0n,n, <ypp"pp'csu'|'p Pl l @\yp p#pp'esu'|'p @`!`!Dyp p%pp' dsu'|'p a!&"a+"  xp0p$pp'0nsu'|'p0 b16#b;#00`xpPp. pp'Plsu'|'pPcQV%c[%PP4p p xy'(u'sfy'䧟q'p @, * `CE$L$@  eAF$eK$@@8`訠*(*cki&ુ&``` `  (a((  d.d.< 고j+ડ+ 爠('( ܶ ! + bà,,   n,0n,  @ ꣠f*ড*` 樠*&* `X` D`" + c   l Pl $`棠f*ড* 訠*(* `ԥ ` `# * e**  @ `!`! $ (`棠f*ড*` 樠*&* `L$` ` % * d**  a!&"a+" ( ,`棠f*ড* ` 樠*&* `Ĥ(` 0`0$ * 0n** 0  b16#b;#0 0棠f*ড*,`$`渠+&+ `@,` 4`P. * Pl** P  cQV%c[%P P棠f*ড*0``(`渠+&+ `ร0` 8`@, * @`** @  eAF$eK$@ @棠f*ড*4`,`渠+&+ `44` <`  * a**   d.d. 棠f*ড*8``0`渠+&+ `ଢ8` @` ! * b**  0 n,n, 棠f*ড*<` `4`渠+&+ `$<` D`" * c**   P l l 棠f*ড*@`$`8`渠+&+ ` @` `# * e**  @ `!`! 棠f*ড*D`(`<`渠+&+ `D` ` % * d**  a!&"a+" 棠f*ড* `,`@`渠+&+ `$ `  *:/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄ0 n35#`<#0  b16# b;#0 0磠g*ৡ*0`D`渠+&+ `.` *P lSU%`\%P  cQV%c[%P P棠f*ড*4`pp `樠*&* `lp,H` pp'@`CE$`L$p@  eAF$eK$@@shy'q'`8p`pxy'*u'`q`p ` ` `&pa..`pppd. d.p`cgi&a&Hp<`H`hi&'e&|r`L`p p!p`'pbce&l&p`ppnaf&0nk&` p ` àg,,p@ppxy'(u'spp"p' pcà,, pppf,Pf, $ೠ`+࠱+ DLLp ' s pp#p'pe pp pl @l s(᳠a+ࡱ+$ ᨠ*!* $p p%p'pd!! p pp`!`!tt, Ⳡb+ࢱ+(   ⨠*"* ( p0p$p 'pn#%","0` ``a!&"jsa+"u' $` 00|'㳠c+ࣱ+,0H0$089#&5#0,0,`L50P0. 00#0P0p00bqv' b{'p40p(P㳠c+ࣱ+00(089#%5#U000P0* 0@0#PlCE$L$0P@PPgAF$gK$@V@80㳠c+ࣱ+40L00hi&#e&040P 0,0 0#P`..0PPPd.d.<0㳠c+ࣱ+80000XY%#U%0Va80P+ P P+ 0%P P0nP+P@0n+ 4P 㣠c*࣡*<0 04089#%5#\W0<0P0!0 0#Pbà,, 0PP Pk,pk, DPD03e9#1#@P0$P08P娠*%*W 0@0P0"00#Pg 0 P P Pl @l P 03e9#1#DP0(P01? 07R# 8 bx b##!<0!80!4<0  00000#40000000 0#40 00001 00#4 00 00 01 00#400000100#400000100#4000#0020 0#40 00'0020$0#40$00 Ѝ0<%A-hM@` pl`T *PdU P!@ }{ {hЍ 0p@-@P`uu00 000000C0pA-@`BpPU Q P@P@-=@S S 4koqtQ0  /0Sp@-@`PS: Q@ Q P0@0zwp/ P@-@PpT0  `0SRuPuP0UJu00 E-@`p6@P0T*0 0S  P0PPP@P0 M- M D` 0H@p0 00[0{0Q  PU u 00 U0E P@@0W0C?o20S2 \  L0T a b888p@-`@"2PPp 0f 22/1 02/3? 0pp@-@`PPp$0f11$ 103? 0pA-@P(p(1`H 3 10@  172/p6o$`84 0 3?,#,8$#4 0M-@P`;P@= : 1 P@jp  10; nP@  0  3? @03? 0T 0 100 0P 0$4O6o0 @`@8@-@P8P5_U $ 2/PU408 8 8M-`(p,@PP 05_R 6P:;78 pЍ0A-`p3_@P }W0 AA-Pp`(@P' 0! P   0  0 P04/  p00 0<P DЍ@-Pp`u@P 0 P   0 ЍM-@Pp`[P1 0&P)p'  @PP 5_ P0 P 40@   40Ѝp@-`P@ 0p@p@-P@`P  P  d0>p@ppM-`Pp8@PY03?S$03?0 @+ PPC  P  SP6$  7p2/$ . @4?(@ @@W&0VU1*0 S 0 C P07p0402003?,#,8$#40Ѝ P p ,0`$0P//// ~]s7@-@P00$0QS  Ѝ00 00( 0$ 0 0 0?00/ီ ( 0 4 <  M-ᤀ(p`_< @0P`0  p`  !   ! Ѝ< ~% p@-\0\`\ P "H@ <00S0Xd00 p@8 ( ( 0 d N h00S/@-P 00cS<@000 S(5d00@@( , 8 xRM-`M .dj0@ Sf0ScpW`PU]|0SY  0 RO0?s0S S G (`,  @{ w s  o 0 z)p0S%  b00ZPP  U`d`0 P@Zdh0d`0\X0PP0Q8D 8@ \8 |d ( Ta |%% @-T@0S H H0?00@ ; 0(B00@%0 ' M-P2b r@ @@ N`pPᘢ`D}i0SSt20S[ Sr S> 0`} UlX@XllX20S10S 10S  8PHp Pv[s[}[+q吱8z[P |1 l^[% 0cT10P03/8AQ  $V[X1~X U 1 0  000@U$,?T0`:@0`HFЍ $  88 W <7t (  4 aV @-M@ 0 3?S{3:0S 0SPD0T 0T 0, 3?0 3?0ۍ t @-M0 Sx 0 3?S{3:0S 0S0S @T,0 ( 8ۍ x @-M0 )h 0 3?S{3:0S  0S @T(0$ @ۍ x @-M0 l 0 3?S{3:0S 0S 0S@T  ۍ A-M0  0 3?S*{3):0S% 0S"0S@T{x`P7w5_/S `W 0@ 0@ۍ Dk@-@=@0S: 0@/Rp@-M` P (0 @01  R0C1 y0T @DA!   ܍pp@-PMMS1A<Ͽ5Ͽ    Pl0@` GL0Uo  0U8080 40@0,00ۍЍp 0 t h  d A-M p` 6?P@0 V 00C1! UP 00 0gC1ڍ襆L00s/@00S/@-M @b 0dC1ڍt A-M p` Ox P$@6? 0P V 00C1! UP$00 0gC1^ڍx @-MMp`7 P$D 6o@0(0,0 p0e$` C1AڍЍ 0@-MM P 0 @ 0 0e C1+ڍЍ0 p@-M`d  0 3?S6{34:0S0 0S0S0S 0S0`" PP QtXQ#XT d`@04OP S00 RP5ۍp %4 0-DM00CS2Xhp 000 $0 0 000 $0 0 $0 0` T0 @0 4000D`DЍ  l %p 1p@-0 QpA0AQj0HlH `|p0Zp|Y|p>p|pppT0K|ppp4A0@X0$@ p A- 1Qq 0Aa0100S10S( #, s S4W :P tDq`0`a0@W W 0S 1P 0 0R W@ WQ W 0yW}ZL0 0 /0  ЍA h 8 l d ( 4 Sf}   d @- 0  @-pP@:W 0 +@0P @``+; p0  00P0QQ?1 H0`D0p00@$ 0 ( 8 ( 4 8 , E-@0S$ S-`+p P PPb x^ FPQ]   I 0 0R0   Ѝ8 $ |1s@-`op100CPSH@<00j @c@_1!0"##0 0 @e;00 "440<0<09 jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-# p$0%<%`% % ixi0k0iiDhgj,jtg8(H@@'@B􄀟􄀮􄀾'<pDHHH #(-27<FP<ԓԚ<ԓ@Ĝ ((    !8 4  xxkx x x {x x xxmpsv{xkxxxxxxxxxxx"4FmmN   ć χ ׇ㇄?Xy  † ކ  2XBZKgp|L ?L ?Xq0X K X 慄  y <܅0? K X c n y΅܅D H@H`HHHۄ ۄ  ۄ @ۄ0ۄ0 ۄ0@ۄ0ۄ@ۄ@ ۄ@@ۄ@ۄ@ۄ@ۄPۄ` ܄`@܄`܄`̺ٺߺ庄麄󺄀  !&+2>DLT\T`e an u{ Żӻۻ㻄黄w}᷄淄󷄀 $48[flryĺȺ GPdbs|øи޸  #=KQ blRbǹไ비 ";F!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      3Dh&  fdt_fixup_memory_bankscomposite_unbindallocate_instancev7_dcache_inval_rangedo_bootvx_fdtprint_part_efifdt_find_or_add_subnodeget_partition_info_efiset_protective_mbrset_default_envdo_gptenv_importenv_exportgpt_restoreext4fs_devreadis_gpt_validalloc_read_gpt_entriesis_pte_validdo_env_exportdev_enum_stordo_env_importusb_get_configuration_nommc_init_streamomap_hsmmc_init_setupmmc_reset_controller_fsmomap_hsmmc_send_cmdmmc_read_datammc_write_datarndis_command_completerx_submitomap_hsmmc_set_iosalloc_requestsdfu_transfer_medium_ramdfu_fill_entity_rameth_bindusb_eth_initusb_eth_sendusb_eth_recvusb_eth_haltdfu_init_env_entitiesdfu_get_bufdfu_get_hash_algodfu_writedfu_readdfu_fill_entitydfu_config_entitiesmmc_access_partmmc_block_opmmc_file_opdfu_write_medium_mmcdfu_get_medium_size_mmcdfu_read_medium_mmcdfu_fill_entity_mmcg_dnl_registermusb_rx_reinitmusb_g_ep0_irqmusb_ep_programmusb_h_ep0_continuemusb_h_ep0_irqmusb_host_rx(((((AAAAAABBBBBB$$bootcmd=run Fatbootbootdelay=1baudrate=115200preboot=run Prebootarch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxloadaddr=88000000Fatboot=env exists loaderdev || env set loaderdev ${fatdev}; env exists UserFatboot && run UserFatboot; echo Booting from: ${fatdev} ${bootfile}; fatload ${fatdev} ${loadaddr} ${bootfile} && bootelf; Netboot=env exists loaderdev || env set loaderdev net; env exists UserNetboot && run UserNetboot; dhcp ${loadaddr} ${bootfile} && bootelf; Preboot=env exists bootfile || bootfile=ubldr; env exists uenv_file || uenv_file=uEnv.txt; env exists SetupFdtfile && run SetupFdtfile; env exists SetupFatdev && run SetupFatdev; env exists SetupUenv && run SetupUenv; env exists UserPreboot && run UserPreboot; SetupFdtfile=if test ${board_name} = A335BONE; then env set fdt_file beaglebone.dtb; elif test ${board_name} = A335BNLT; then env set fdt_file beaglebone-black.dtb; fi; SetupFatdev=env exists fatdev || fatsize ${fatdev:=mmc 0} ${bootfile} || fatdev='mmc 1'; SetupUenv=fatload ${fatdev} ${loadaddr} ${uenv_file} && env import -t ${loadaddr} ${filesize}; , !Device Firmware Upgrade0123456789ABCDEFEthernet Gadgetarocsdxbim $0123456789abcdefLZO  Texas Instrumentsmusb-hdrc~~EPTGMKUSB download gadget   ;kCould not probe the EEPROM; something fundamentally wrong on the I2C bus. Could not read the EEPROM; something fundamentally wrong on the I2C bus. Incorrect magic number (0x%x) in EEPROM Could not get board ID. board_nameboard_rev not set. Validating first E-fuse MAC eth1addrA335BONEA335BNLTSKU#02Error %d registering CPSW switch A335X_SKA33515BBError %d registering USB_ETHER usbnet_devaddr%s=%sAPI: could not allocate memory for the signature! UBootAPImmcusbERROR @ %s(): group%d - out of order iteration ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x usbethaddr(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s bootargsFDT creation failed! hanging...Bad Linux ARM zImage magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] /memory## WARNING: fixup memory failed! Resetting CPU ... pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... WARNING: Caches not enabled verpreboot%s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands U-Boot# Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d %s for %08lx ... %08lx ==> Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded sha256crc32syntax error ERROR : memory not allocated %s=%s ** Abort ## Error: "%s" not defined *?[\%uERROR: There is a global environment variable with the same name. %s: readonly variableHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS \$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildone** Too many args (max. %d) ** ## Command too long! %.*s%*s CksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format bootcountbootlimitbootdelayWarning: Bootlimit (%u) exceeded. Using altbootcmd. altbootcmdHit any key to stop autoboot: %2d %2d DRAM: Watchdog enabled I2C: baudrateMMC: Net: loadaddr## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! autostartyesAutomatic boot of image at addr 0x%08lX ... Your platform's zImage format isn't supported yet! bootzboot Linux zImage image from memoryiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadosramdiskcmdlinebdtprepfakeRamdisk image is corrupt or invalid Could not find a valid device tree verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image load address! ERROR: unknown image format type! Can't get entry point property! Could not find kernel entry point! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover LZO: uncompress or overwrite error %d - must RESET board to recover Unimplemented compression type %d WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand not supported ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... nofilesize## Transferring control to NetBSD stage-2 loader (at address %08lx) ... /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated alias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command' %s arm-none-eabi-gcc (FreeBSD Ports Collection for armnoneeabi) 4.9.1 GNU ld (GNU Binutils) 2.25 print monitor, compiler and linker version.callbacks:callbacks,.flags:flags,baudrate:baudrate,bootfile:bootfile,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,.callbacksethaddr:ma,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" ** Unable to use %s %d:%d for saveenv ** u-boot.env ** Unable to write "%s" from %s%d:%d ** ** Unable to use %s %d:%d for loading the env ** ** Unable to read "%s" from %s%d:%d ** FATBad magic number Bad header crc Bad data crc Bad image type Empty Script No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory%-12s= 0x%08lX (not set)arch_numberboot_paramsDRAM bank-> start-> sizeeth%dname = %s eth%iaddr%-12s= %s current eth = %s ipaddrip_addr = %s baudrate = %u bps TLB addrrelocaddrreloc offirq_spsp start bdinfoprint Board Info structureflushNo arch specific invalidate_icache_all available! OFFInstruction Cache is %s No arch specific flush_dcache_all available! Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheList of available devices: %-8s %08x %c%c%c coninfoprint console devices and information\cecho args to console[args..] - echo args to console; \c suppresses newlineread EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... eepromEEPROM sub-systemread devaddr addr off cnt eeprom write devaddr addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddreth(0,0)bootfile%s:%s srv%s:file e=%s serveriph=%s hostnametn=%s ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ** Unable to use %s %d:%d for fatwrite ** ** Unable to write "%s" from %s %d:%d ** %ld bytes written fatwritewrite file into a dos filesystem - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %d", "* 0x%p [0x%08x]<0x%08x%s[%02x%sfdtaddr/* NULL pointer error */The address of the fdt is %#08lx New length %d < existing length %d, ignoring. libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commands#address-cells#size-cells%s: %s: %s fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. linux,initrd-endfdt_chosen: %s WARNING: could not set bootargs %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernet%deth%daddrlocal-mac-address%s: Bad cell count for %s rangeslinux,phandleCan't set phandle %u: %s okaydisabledfailfail-%dInvalid fdt status: %x Warning: device tree alias '%s' points to invalid node %s. Warning: device tree node '%s' has no address. Warning: U-Boot configured device %s at address %llx, but the device tree has it address %llx. default [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %i) value is %lu query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsError writing the chip. Error reading the chip. Valid chip addresses: %02X%04x: %02xCurrent bus is %d Invalid bus %d Setting bus to %d Failure changing bus number (%d) CRC32 for %08lx ... %08lx ==> Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sError writing to the chip. %08lx: Error reading the chip, %02lx %04lx %08lx ? i2cI2C sub-systembusdevloopmmmwnmprobeUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=## Total Size = 0x%08x = %d Bytes ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx Zero length ??? double wordbytehalfword%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %04xinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]NULL device name! BUG: failure at %s:%d/%s()! common/miiphyutil.cBUG!miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' mdio_register: non unique device name '%s' %s: %d - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplex read failed, assuming half duplex FDXHDX10100fullhalfIEEE 802.3???IEEE 802.9 ISLAN-16TPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %smiiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.next page ableacknowledgeremote fault(reserved)asymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registerPHY does not have extended functions Reading from bus %s PHY at address %d: %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)No MMC device available no mmc device at slot %x OKERROR#part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s YesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: Bus Width: %d-bit OK, force rescanset dsr %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan mmc part - lists available partition on current mmc device mmc dev [dev] [part] - show or set current mmc device [partition] mmc list - lists available devices mmc setdsr - set DSR register value eraselistsetdsrgatewayipnetmaskrootpathdnsipdnsip2domainping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootboot image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoluuiddisk partition related commandspart uuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition tablemallocWrittenReadFailed to initialize SPI flash at %u:%u No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) Failed to map physical memory Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: %s SF: %zu bytes @ %#x Erased: %s sfSPI flash sub-systemprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset len - read `len' bytes starting at `offset' to memory at `addr' sf write addr offset len - write `len' bytes from memory at `addr' to flash at `offset' sf erase offset [+]len - erase `len' bytes from `offset' `+len' round up `len' to block size sf update addr offset len - erase and write `len' bytes from memory at `addr' to flash at `offset'Hex conversion error on %c Invalid bitlen %d Invalid device %d:%d Error during SPI transaction sspiSPI utility command[:][.] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Number of bits to send (base 10) - Hexadecimal string that gets sent-ztruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-n-eSee InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d (Re)start USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: infconfig for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s USB device %d: unknown device Device %d: ... is now current device 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'failed to stop USB controller %d unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) %s: failed to get descriptor - too long: %d selecting invalid interface %dERROR, too many USB Devices, max=%d Cannot allocate device context to get SLOT_ID usb_new_device:cannot locate device's port. Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX USB%d: scanning bus %d for devices... %d USB Device(s) found No USB Device found lowlevel init failed Port not available. USB error: all controllers failed lowlevel init cannot reset port %i!? ERROR: USB_MAX_HUB (%d) reached Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X No storage devices, perhaps not 'usb start'ed..? USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR scanning usb for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Could not find script subimage compression type Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Subcommand failed Argument image is now in RAM: 0x%p Argument image is now in RAM at: 0x%p splSPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. exportatagsusb_dnl_dfuDevice Firmware Upgrade [list] - device firmware upgrade via on device , attached to interface [list] - list available alt settings ${'%s' is not a number %s: %s dev %d NOT available Writing GPT: ;uuid_diskWrong uuid format for partition %d No partition list provided Missing disk guid Partition list incomplete success! gptGUID Partition Table - GUID partition table restoration Restore GPT information on a device connected to interface Saving Environment to %s... ## Error: cannot export environment Environment size: %d/%ld bytes ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: bad CRC, import failed ERROR: Environment import failed: errno = %d at %s:%d/%s() common/cmd_nvedit.c## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d Please enter '%s': setenvERROR: Cannot export environment: errno = %d at %s:%d/%s() %zXenv_buf [%d bytes] too small for value of "%s" edit: runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variables[-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditimportprintsaveexistssaveenvsave environment variables to persistent storage*** Warning - %s, using default environment Using default environment common/env_common.c!bad CRCERROR: Cannot import environment: errno = %d at %s:%d/%s() !import failedy Y yes YES stdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! bootm_lowbootm_sizebootm_mapsize%d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... noneuncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedaisimageDavinci AIS imageFilesystem ImagefirmwareFirmwareflat_dtFlat Device TreegpimageTI Keystone SPL ImagekernelKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SOCFPGA preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot ImageInvalid OSlinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSu-bootU-BootvxworksVxWorksqnxQNXInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64ERROR: - must RESET the board to recover. reserving fdt memory region: addr=%llx size=%llx image is not a fdtfdt_highFailed using fdt_high value for Device Treedevice tree - allocation error Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: /chosen node create failedERROR: arch specific fdt fixup faileddescriptiontimestamp/imagesarchcompressionentrydata%s %s algo: invalid/unsupported key-name-hintrequired:%s (required)%s %s value: unavailable %s Timestamp: %s Description: %s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Entry Point: hashHashsignatureSignCan't set '%s' property for '%s' node (%s) sha1md5Can't get hash algo propertyCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get image data/sizeCorrupted or truncated treeuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't find images parent node '%s' (%s) ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): /configurationscompatible%s Kernel: %s Init Ramdisk: %s %s FDT: %s %sFIT description: %sCreated: %s Image %u (%s) %s Default Configuration: '%s' %s Configuration %u (%s) Verifying Hash Integrity ... unknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! Could not find configuration node Using '%s' configuration Could not find subimage node Trying '%s' %s subimage Unsupported Architecture FDT image is compressedNo Linux %s %s Image Could not find %s subimage data! Subimage data is not a FDTCan't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Partition Map for IDESATAATAPIUSBDOCHOSTUNKNOWN device %d -- Partition Type: %s (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available DOSEFI## Unknown partition table ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** ** Bad device %s %s ** hostfsSandbox hostbootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** Whole Disk** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") FAT32 Extd Boot** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x %3d %-10d %-10d %08x-%02x %02x%s%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d%08x-%02xPart Start Sector Num Sectors UUID Type %s: calloc failed! ** Can't write to device %d ** %s: Invalid Argument(s) *** ERROR: Can't read GPT header *** GUID Partition Table Header signature is wrong:0x%llX != 0x%llX GUID Partition Table Header CRC is wrong:0x%x != 0x%x GPT: my_lba incorrect: %llX != %llX GPT: first_usable_lba incorrect: %llX > %llX GPT: last_usable_lba incorrect: %llX > %llX %s: ERROR: Can't allocate 0x%zX bytes for GPT Entries *** ERROR: Can't read GPT Entries *** GPT: Failed to allocate memory for PTE GUID Partition Table Entry Array CRC is wrong:0x%x != 0x%x %s: *** ERROR: Invalid GPT *** %s: *** ERROR: Invalid Backup GPT *** %s: *** Using Backup GPT *** Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %s guid: %s Partition overlap Partitions layout exceds disk size Partition no. %d: invalid guid: %s dfu_bufsiz%s: Could not memalign 0x%lx bytes DFU complete %s: 0x%08x %s: Wrong sequence number! [%d] [%d] ERROR: Buffer overflow! (0x%p + 0x%x > 0x%p) at %s:%d/%s() drivers/dfu/dfu.c%s: File too big for buffer %s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... dfu_hash_algoERROR: DFU hash method: %s not supported! at %s:%d/%s() ERROR: Hash algorithm %s not supported at %s:%d/%s() nandNAND support not available! SF support not available! %s: Device %s not (yet) supported! dfu_alt_infoERROR: "dfu_alt_info" env variable not defined! at %s:%d/%s() ERROR: DFU entities configuration failed! at %s:%d/%s() DFU alt settings list: dev: %s alt: %d name: %s layout: %s RAW_ADDREXT2EXT3EXT4RAM_ADDReMMCOneNANDRAMfatext4%s: Layout (%s) not (yet) supported! %s%s mmc %d:%d 0x%x %lxdfu: Read error! dfu: Wrong file size! ERROR: Cannot switch to partition %d at %s:%d/%s() drivers/dfu/dfu_mmc.cRequest would exceed designated area! ERROR: Operation not supported at %s:%d/%s() ERROR: MMC operation failed at %s:%d/%s() ERROR: Invalid number of arguments. at %s:%d/%s() ERROR: Couldn't find MMC device no. %d. at %s:%d/%s() ERROR: Couldn't init MMC device. at %s:%d/%s() rawmmcpartERROR: Couldn't find part #%d on mmc device #%d at %s:%d/%s() ERROR: Memory layout (%s) not supported! at %s:%d/%s() ERROR: unsupported layout: %s at %s:%d/%s() drivers/dfu/dfu_ram.cERROR: request exceeds allowed area at %s:%d/%s() ERROR: unsupported device: %s at %s:%d/%s() ERROR : check_gpio: invalid GPIO %d omap3-gpio unknown bank method %s %d drivers/gpio/omap_gpio.cError, wrong i2c adapter %d max %d possible wrong hwadapnr: %d Error : I2C initializing first phase clock Error : I2C initializing clock Timed out in wait_for_bb: status=%04x Timed out in wait_for_event: status=%04x Check if pads/pull-ups of bus %d are properly configured I2C write: addr len < 0 I2C write: data len < 0 I2C write: NULL pointer passed I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c_write: pads on bus %d probably not configured (status=0x%x) i2c_write: error waiting for addr ACK (status=0x%x) i2c_write: bus not ready for addr Tx (status=0x%x) i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! I2C read: addr len < 0 I2C read: data len < 0 I2C read: NULL pointer passed I2C read: addr len %d not supported I2C read: address out of range i2c_read (addr phase): pads on bus %d probably not configured (status=0x%x) i2c_read: error waiting for addr ACK (status=0x%x) i2c_read (data phase): pads on bus %d probably not configured (status=0x%x) i2c_probe: pads on bus %d probably not configured (status=0x%x) ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! omap24_2omap24_1omap24_0Status Error: 0x%08X Timeout waiting card ready MMC Device %d not found MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card doesn't support part_switch MMC: SET_DSR failed Man %06x Snr %04x%04x%c%c%c%c%c%c%s is deprecated! use mmc_create() instead. MMC: no card present Card did not respond to voltage select! Discarding further error messages %s: %d%s: timedout waiting for ics! %s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s: timedout waiting for STAT (%x) to clear %s : timeout: No status update %s: timedout waiting for status! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! mmc_cdmmc_wpOMAP SD/MMC Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed W25P80W25P16W25P32W25X40W25X16W25X32W25X64W25Q80BLW25Q16CLW25Q32BVW25Q64CVW25Q128BVW25Q256W25Q80BWW25Q16DWW25Q32DWW25Q64DWW25Q128FWSF: Failed to set up slave SF: Failed to get idcodes SF: Need set QEB func for %02x flash SF: Detected %s with page size , erase size , total , mapped at %pSF: Warning - Only lower 16MiB accessible, Full access #define CONFIG_SPI_FLASH_BAR SF: Unsupported flash IDs: manuf %02x, jedec %04x, ext_jedec %04x wait_for_user_access Timeout cpdma_process timeout link up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc cpswFailed to allocate PHY device for %s:%d %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Phy not found PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Cannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted SPI error: unsupported bus %i. Supported busses 0 - 3 SPI error: unsupported chip select %i on bus %i SPI error: unsupported frequency %i Hz. Max frequency is 48 Mhz SPI error: unsupported SPI mode %i SPI error: malloc of SPI structure failed SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x omap3_spi: invalid wordlen %d drivers/usb/gadget/composite.ccompositeusb_dnloadmusb-hdrc%s: failed!, error: %d DOWNLOAD ... OK Ctrl+C to exit ... ERROR: %s: rndis parse error %d at %s:%d/%s() drivers/usb/gadget/ether.cUSB RNDIS network up! ERROR: No memory to alloc RNDIS packet at %s:%d/%s() timeout sending packets to usb ethernet ERROR: can't alloc requests at %s:%d/%s() ERROR: received NULL ptr at %s:%d/%s() ERROR: rx submit --> %d at %s:%d/%s() ERROR: dev->rx_req invalid at %s:%d/%s() RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s ERROR: can't autoconfigure on %s at %s:%d/%s() ERROR: can't run RNDIS on %s at %s:%d/%s() %02X%02X%02X%02X%02X%02XERROR: can't init RNDIS, %d at %s:%d/%s() using %s, OUT %s IN %s%s%s STATUS HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready ERROR: %s failed, status = %d at %s:%d/%s() RNDIS/%sU-bootERROR: controller '%s' not recognized at %s:%d/%s() de:ad:be:af:00:00usbnet_hostaddrERROR: Need valid 'usbnet_devaddr' to be set at %s:%d/%s() ERROR: Need valid 'usbnet_hostaddr' to be set at %s:%d/%s() cdc_connect_timeoutERROR: The remote end did not respond in time. at %s:%d/%s() usb_etherEthernet DataRNDIS Communications Controlep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! WARNING in %s line %d drivers/usb/musb-new/musb_gadget_ep0.cidlesetupin/statusout/statuswaitUTMI-16UTMI-8drivers/usb/musb-new/musb_core.c, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%smusb_init_controller failed with status %d Failed to enqueue URB to controller MUSB host is not registered bad parameter. Controller uninitialized gadget_start failed with %d bind failed with %d Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! ** Unrecognized filesystem type ** ** Unable to read file %s ** ** Unable to write file %s ** ** No boot file defined ** %d bytes read in %lu ms (%d bytes written in %lu ms** Can not find directory. ** ** Cannot support non-zero offset ** ** File not found %s ** Extent Error ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** invalid extent block < ? > %10d %s Failed to mount ext2 filesystem... %s read outside partition %lu ** ext2fs_devread() read error ** ** %s read error - block * %s read error - last part error: overflow occurs Error: Invalid FAT entry: 0x%08x FAT: Misaligned buffer address (%p) FAT32 FAT12 FAT16 Invalid FAT entry error: wrinting directory entry Error: reading directory block Error: %ld overflow Error: writing contents Error: flush fat buffer Error: writing directory entry Error: finding empty cluster Error: clearing FAT entries U** Partition %d not valid on device %d ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: Unknown Device %d: No valid FAT fs found Filesystem: %s "%s" reading %s writing %s Can't list files without a filesystem! %s/%sCan't load file without a filesystem! invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header initcall sequence %p failed at call %p ERROR: Failed to allocate 0x%lx bytes below 0x%lx. .%03ldlist passed to list_sort() too long for efficiency ## ERROR: unsupported match method: 0x%02x Env export buffer too small: %zu, but need %zu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %s %llu Bytes%s%lu.%ld %ciB%s %0*x### ERROR ### Please RESET the board ### %s:%u: %s: Assertion `%s' failed.%*lluFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUT## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE BOOTP broadcast %d Retry time exceeded; starting again ethact%pM%s%daddr%saddrnet/eth.ceth%dmacskipethmacskip Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM Warning: %s using MAC address from net device Error: %s address not set. Warning: %s failed to set MAC address Error: %s address %pM illegal value Board Net Initialization Failed CPU Net Initialization Failed Net Initialization Skipped ethprime [PRIME] Warning: eth device name has a space! ethethrotateautoloadNFSnetretryonce ICMP Host Redirect to %pI4 %d.%d.%d.%dnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %ld (%lx hex) *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cFile too largeFile has bad magicblksize TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) Not retrying... %s; starting again Retry count exceededtftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms TFTP %s server %pI4; our IP address is %pI4fromFilename '%s'.Load address: 0x%lx $( w U-Boot 2014.10 (Jan 02 2015 - 05:22:36)  JJ  l @24L$24|$@I t.X. .GI---KKDK8IKNK SKVKZK `K ㅄ fK dkkTkkmllm;k\kLkmlmhmlllnkkkkln4lHldllnHnll8m mo\pLp o4o(pnPpDolll - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSA\RRƽ !R@)R-R2R̈́[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Z[addr] - run script starting at addr - A valid image header must be present For FIT format uImage addr must include subimage unit name in the form of addr: addr [-c] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize - Resize fdt to size + padding to 4k addr fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value - Get and store in fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header - Display header info fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start/end addr NOTE: Dereference aliases by omiting the leading '/', e.g. fdt print ethernet0./bus [muxtype:muxaddr:muxchannel] - show I2C bus info crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length - write memory to i2c i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedwlÀGIw(w4ŀMLwȀww Ȁw9_rfDĀmN伀怄€@卄|9_rfj􀀝ALwpuaddr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to ƽ櫄A\RRƽ!R)R-RA\RR!R)R-R߫ask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] @\r4Z별@T򳄀;$$4llބ15 ."߄/8 .ބ/5 .߄/8 .eserial0,=?@??>>eserial1`=?H??>>eserial2=?P??>?eserial3=@X??> ?eserial4= @`??>?eserial50>@h??>?%  d t_R RpQTT(PPAgA!   ! (!@@1" ۢi儀΢ ℀w儀|lwrll !{A@:<6<Y"A8!!  @!{A@:<6<!AA!! Ethernet Gadget !! L!      @  @  @               @\͂͂4͂X͂@P|΂<(ׂXւււXׂ΂₀΂΂΂΂΂΂΂@\ϱ5}ڀ:}V}\\8䄀0rQQ0rQ4b>@@@@HALAPATADCHCLCPCTCXC\CdFhFlF|F`HdHhHlHpHtHxH|HKKKLL LLLLL L$L(L,L0L4L8L